Edit |   |
---|---|
Antigenic Specificity | OAS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-OAS1 polyclonal antibody, unconjugated |
Immunogen | OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS |
Other Names | OAS1|2'|5'-oligoadenylate synthetase 1|2',5'-oligoadenylate synthetase 1|2',5'-Oligoadenylate Synthetase 1, 40/46kDa|4046kDa|2'-5'-oligoadenylate synthase 1|2'-5'-oligoadenylate synthetase 1|(2-5')oligo(A) synthase 1|(2-5')oligo(A) synthetase 1|2'-5' oligoadenylate synthetase|2-5A synthase 1|2-5A synthetase 1|p42 OAS|2-5-oligoadenylate synthetase 1|2'-5' oligoadenylate synthetase 1|IFI-4|OIAS|OIASI|5'-oligo A synthetase 1|2'-5' oligoadenylate synthetase 1 p48 isoform|2'-5' oligoadenylate synthetase 1 p52 isoform|2'-5'-oligoisoadenylate synthetase 1|E18E16|p46p42 OAS|2'-5'-oligoadenylate synthetase 1-like|L3|(2-5')oligo(A) synthase 1A|(2-5')oligo(A) synthetase 1A|2'-5'-oligoadenylate synthase 1A|2-5A synthase 1A|2-5A synthetase 1A|2'-5' oligoadenylate synthetase 1A|Oas1a|Pp2a2|PP2A-beta|protein phosphatase 2 (formerly 2A)|catalytic subunit|beta isoform|protein phosphatase 2|protein phosphatase 2A catalytic alpha subunit|protein phosphatase 2a|protein phosphatase-2A-beta|serine hreonine-protein phosphatase 2A catalytic subunit beta isoform|protein phosphatase 2 catalytic subunit beta|Ppp2cb|LOW QUALITY PROTEIN: 2'-5'-oligoadenylate synthase 1 |
Gene, Accession # | Gene ID: 4938 |
Catalog # | ABIN634460 |
Price | $1020 |
Order / More Info | OAS1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |