Edit |   |
---|---|
Antigenic Specificity | P2RX4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-P2RX4 polyclonal antibody, unconjugated |
Immunogen | P2 RX4 antibody was raised using the N terminal of P2 X4 corresponding to a region with amino acids VQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIW |
Other Names | P2X4|P2X4R|ATP receptor|ATP-gated cation channel protein|P2X purinoceptor 4|P2X receptor|subunit 4|purinergic receptor P2X4|purinoceptor P2X4|purinergic receptor P2X 4|P2RX4|Purinergic Receptor P2X, Ligand-Gated Ion Channel, 4|P2X4 purinoceptor|purinergic receptor P2X|ligand-gated ion channel|4|p2X purinoceptor 4-like|AI504491|AW555605|D5Ertd444e|ionotropic purinergic receptor|purinergic receptor P2X, ligand-gated ion channel 4|wu:fi03f02|etID14865.21|zP2X4.1|purinergic receptor P2X, ligand-gated ion channel, 4a|p2rx4a|ATP-gated ion channel subunit P2X4|purinergic receptor P2X, ligand gated ion channel, 4 L homeolog|p2rx4.L|purinergic receptor P2X4 subunit variant 1|purinergic receptor P2X4 subunit variant 2|p2rx4.2|p2xr4.2|purinergic receptor P2X4b|purinergic receptor P2X, ligand-gated ion channel, 4b|p2rx4b |
Gene, Accession # | Gene ID: 5025 |
Catalog # | ABIN633745 |
Price | $1020 |
Order / More Info | P2RX4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |