Edit |   |
---|---|
Antigenic Specificity | Calmegin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Calmegin polyclonal antibody, unconjugated |
Immunogen | Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL |
Other Names | calmegin|CLGN|4930459O04Rik|AI528775|Cln|A26|MEG 1 antigen|calnexin-T|canx|fj49d10|wu:fj24b04|wu:fj49d10|zgc:153946|calnexin|calmegin-like|LOW QUALITY PROTEIN: calmegin |
Gene, Accession # | Gene ID: 1047 |
Catalog # | ABIN630467 |
Price | $902 |
Order / More Info | Calmegin Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |