Edit |   |
---|---|
Antigenic Specificity | MAP3K7CL |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MAP3K7CL polyclonal antibody, unconjugated |
Immunogen | C21 ORF7 antibody was raised using the C terminal Of C21 rf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA |
Other Names | C21orf7|HC21ORF7|TAK1L|TAKL|TAKL-1|TAKL-2|TAKL-4|MAP3K7 C-terminal-like protein|TAK1-like protein 1|TAK1-like protein 2|TAK1-like protein 4|TGF-beta activated kinase|MAP3K7 C-terminal like|MAP3K7CL|ORF63|TAK1-like protein |
Gene, Accession # | Gene ID: 56911, 224419 |
Catalog # | ABIN629829 |
Price | $902 |
Order / More Info | MAP3K7CL Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |