Edit |   |
---|---|
Antigenic Specificity | PABPC4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PABPC4 polyclonal antibody, unconjugated |
Immunogen | PABPC4 antibody was raised using the N terminal of PABPC4 corresponding to a region with amino acids AELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKS |
Other Names | APP-1|APP1|PABP4|iPABP|PABP-4|activated-platelet protein 1|inducible poly(A)-binding protein|poly(A)-binding protein 4|polyadenylate-binding protein 4|poly(A) binding protein cytoplasmic 4|PABPC4|Poly(A) Binding Protein, Cytoplasmic 4 (Inducible Form)|poly(A) binding protein, cytoplasmic 4|poly(A) binding protein|cytoplasmic 4 (inducible form)|Bm1_06880|cb12|sb:cb12|PABP|ePAB|ePABP|poly(A) binding protein cytoplasmic 4 L homeolog|pabpc4.L|poly A binding protein|cytoplasmic 4 |
Gene, Accession # | Gene ID: 8761, 482464 |
Catalog # | ABIN629988 |
Price | $902 |
Order / More Info | PABPC4 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |