Edit |   |
---|---|
Antigenic Specificity | NrCAM |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NrCAM polyclonal antibody, unconjugated |
Immunogen | NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids NLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTP |
Other Names | NgCAM-related cell adhesion molecule|neuronal surface protein Bravo|neuronal cell adhesion molecule|NRCAM|Bravo|C030017F07Rik|C130076O07Rik|mKIAA0343|mBravo|ng-CAM-related|nr-CAM|Nr-CAM protein|gBravo|neuronal cell adhesion molecule L homeolog|nrcam.L|ankyrin-binding cell adhesion molecule NrCAM|neuron-glia-CAM-related cell adhesion molecule|rBravo|neuronal cell adhesion protein|si:dkey-240a12.1|neuronal cell adhesion molecule a|nrcama|neuronal cell adhesion molecule-like |
Gene, Accession # | Gene ID: 4897 |
Catalog # | ABIN630314 |
Price | $902 |
Order / More Info | NrCAM Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |