Edit |   |
---|---|
Antigenic Specificity | ATE1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATE1 polyclonal antibody, unconjugated |
Immunogen | ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM |
Other Names | R-transferase 1|arginine-tRNA--protein transferase 1|arginyl-tRNA--protein transferase 1|arginyl-tRNA-protein transferase|arginyltransferase 1|ATE1|AI225793|AW547406|arginine-tRNA-protein transferase 1|zgc:158849|arginyltransferase 1 L homeolog|ate1.L|arginyl-tRNA--protein transferase 1-like|Ate|CG9204|Dm-Ate1|DmelCG9204|l(2)k10809|Ate1-PA|Ate1-PB|Ate1-PC|Ate1-PD|CG9204-PA|CG9204-PB|CG9204-PC|CG9204-PD|CG9204 gene product from transcript CG9204-RA |
Gene, Accession # | Gene ID: 11101 |
Catalog # | ABIN630829 |
Price | $1020 |
Order / More Info | ATE1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |