Edit |   |
---|---|
Antigenic Specificity | CES5A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CES5A polyclonal antibody, unconjugated |
Immunogen | Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP |
Other Names | CAUXIN|CES4C1|CES5|CES7|carboxylesterase 5|carboxylesterase 7|carboxylesterase-like urinary excreted protein homolog|carboxylesterase 5A|CES5A|1700081L16Rik|1700122C07Rik|BB081581|Gm503|carboxylesterase 615|epididymis-specific gene 615 protein|LOC445455|carboxylesterase-like urinary excreted protein|epididymis-specific carboxylesterase |
Gene, Accession # | Gene ID: 221223 |
Catalog # | ABIN634041 |
Price | $1020 |
Order / More Info | CES5A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |