Edit |   |
---|---|
Antigenic Specificity | NAA15 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-NAA15 polyclonal antibody, unconjugated |
Immunogen | NARG1 antibody was raised using the N terminal of NARG1 corresponding to a region with amino acids LRPAQRASWIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSEL |
Other Names | Ga19|NARG1|NATH|TBDN100|N-alpha-acetyltransferase 15|NatA auxiliary subunit|N-terminal acetyltransferase|NMDA receptor regulated 1|NMDA receptor-regulated protein 1|gastric cancer antigen Ga19|protein tubedown-1|transcriptional coactivator tubedown-100|tubedown-1|N(alpha)-acetyltransferase 15, NatA auxiliary subunit|NAA15|narg1l|N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog|naa15.S|NMDA receptor-regulated gene 1|5730450D16Rik|6330400I15|ASTBDN|Tbdn-1|mNAT1|N-terminal acetyltransferase 1|N-terminal aceyltransferase 1|tubedown|NMDA receptor-regulated protein 1-like protein |
Gene, Accession # | Gene ID: 74838, 80155, 310399 |
Catalog # | ABIN633172 |
Price | $1020 |
Order / More Info | NAA15 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |