Edit |   |
---|---|
Antigenic Specificity | FKBP3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-FKBP3 polyclonal antibody, unconjugated |
Immunogen | FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID |
Other Names | FKBP-25|FKBP-3|FKBP25|PPIase|25 kDa FK506-binding protein|25 kDa FKBP|FK506-binding protein 25|T-cell|FK506-binding protein 3 (25kD)|PPIase FKBP3|immunophilin FKBP25|peptidyl-prolyl cis-trans isomerase FKBP3|rapamycin binding protein|rapamycin-selective 25 kDa immunophilin|rotamase|FK506 binding protein 3|FKBP3|FK506 Binding Protein 3, 25kDa|FK506|fb75c04|si:dz261o22.2|wu:fb75c04|zgc:110728|25kDa|FK506 binding protein 3 L homeolog|fkbp3.L|putative FK506-binding protein|FK506-binding protein 3|potential nucleolar FKBP-type peptidylprolyl cis rans isomerase|peptidylprolyl isomerase|CAALFM_C103790CA |
Gene, Accession # | Gene ID: 2287, 30795, 299104 |
Catalog # | ABIN630860 |
Price | $1020 |
Order / More Info | FKBP3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |