Edit |   |
---|---|
Antigenic Specificity | Transferrin Receptor 2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Transferrin Receptor 2 polyclonal antibody, unconjugated |
Immunogen | TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP |
Other Names | HFE3|TFRC2|transferrin receptor protein 2|transferrin receptor 2|TFR2|Trfr2|zgc:123043|transferrin receptor protein 2-like |
Gene, Accession # | Gene ID: 7036, 50765, 288562 |
Catalog # | ABIN635270 |
Price | $1020 |
Order / More Info | Transferrin Receptor 2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |