Edit |   |
---|---|
Antigenic Specificity | Syntaxin 19 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Syntaxin 19 polyclonal antibody, unconjugated |
Immunogen | Syntaxin 19 antibody was raised using the N terminal of STX19 corresponding to a region with amino acids LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR |
Other Names | A030009B12Rik|syntaxin 9|syntaxin-19|syntaxin 19|Stx19|syntaxin 19 L homeolog|stx19.L |
Gene, Accession # | Gene ID: 68159, 415117, 685180 |
Catalog # | ABIN631981 |
Price | $1020 |
Order / More Info | Syntaxin 19 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |