Edit |   |
---|---|
Antigenic Specificity | MASP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MASP2 polyclonal antibody, unconjugated |
Immunogen | MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Other Names | MAP19|MASP-2|MASP1P1|sMAP|MBL-associated plasma protein of 19 kD|MBL-associated serine protease 2|mannan-binding lectin serine peptidase 1 pseudogene 1|mannan-binding lectin serine protease 1 pseudogene 1|mannan-binding lectin serine protease 2|mannose-binding protein-associated serine protease 2|small MBL-associated protein|mannan binding lectin serine peptidase 2|MASP2|Mannan-Binding Lectin serine Peptidase 2|mannose binding lectin-associated serine protease-2|sb:eu714|wu:fb62a09|mannan-binding lectin serine peptidase 2 variant 1|mannan-binding lectin serine peptidase 2 variant 2|mannan-binding lectin serine peptidase 2 variant 3|mannan-binding lectin serine peptidase 2 variant 4 |
Gene, Accession # | Gene ID: 10747, 17175 |
Catalog # | ABIN634492 |
Price | $1020 |
Order / More Info | MASP2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |