Edit |   |
---|---|
Antigenic Specificity | Integrin alpha 3B, alpha 6B |
Clone | PB36 |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG1 |
Format | unconjugated |
Size | 0.1 mg |
Concentration | n/a |
Applications | Immunocytochemistry, Immunohistochemistry, Immunohistochemistry (Frozen Sections), Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-Integrin alpha 3B, alpha 6B monoclonal antibody, unconjugated |
Immunogen | PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin. |
Other Names | n/a |
Gene, Accession # | n/a |
Catalog # | ABIN335348 |
Price | $462 |
Order / More Info | Integrin alpha 3B, alpha 6B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |