Edit |   |
---|---|
Antigenic Specificity | IL1A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IL1A polyclonal antibody, unconjugated |
Immunogen | IL1 alpha antibody was raised using the N terminal of IL1 A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS |
Other Names | IL-1A|IL1|IL1-ALPHA|IL1F1|IL-1 alpha|hematopoietin-1|interleukin-1 alpha|preinterleukin 1 alpha|pro-interleukin-1-alpha|interleukin 1 alpha|IL1A|IL-6|interleukin-6|interleukin 6|IL6|IL-1alpha|interleukin 1-alpha|precursor interleukin 1 alpha|L1A|precursor interleukin-1alpha |
Gene, Accession # | Gene ID: 3552 |
Catalog # | ABIN634266 |
Price | $1020 |
Order / More Info | IL1A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |