Edit |   |
---|---|
Antigenic Specificity | PABPC1L2A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PABPC1L2A polyclonal antibody, unconjugated |
Immunogen | PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL |
Other Names | RBM32A|RNA binding motif protein 32A|RNA-binding motif protein 32|RNA-binding protein 32|polyadenylate-binding protein 1-like 2|poly(A) binding protein cytoplasmic 1 like 2A|PABPC1L2A|Poly(A) Binding Protein, Cytoplasmic 1-Like 2A|LOW QUALITY PROTEIN: polyadenylate-binding protein 1-like 2|poly(A) binding protein|cytoplasmic 1-like 2A|LOC100146150|Pabpc1l2b|RGD1566367|Rbm32b|RNA binding motif protein 32B|cytoplasmic 1-like 2B |
Gene, Accession # | Gene ID: 340529 |
Catalog # | ABIN633510 |
Price | $1020 |
Order / More Info | PABPC1L2A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |