Edit |   |
---|---|
Antigenic Specificity | CNTNAP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CNTNAP1 polyclonal antibody, unconjugated |
Immunogen | CNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS |
Other Names | CASPR|CNTNAP|NRXN4|P190|caspr1|contactin-associated protein 1|neurexin 4|neurexin IV|neurexin-4|contactin associated protein 1|CNTNAP1|AI841080|NCP1|shm|MHDNIV|neurexin 4 (contactin associated protein)|paranodin|contactin associated protein-like 1|contactin-associated protein 1-like |
Gene, Accession # | Gene ID: 8506 |
Catalog # | ABIN634731 |
Price | $1020 |
Order / More Info | CNTNAP1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |