Edit |   |
---|---|
Antigenic Specificity | TNRC6B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TNRC6B polyclonal antibody, unconjugated |
Immunogen | TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG |
Other Names | trinucleotide repeat-containing gene 6B protein|trinucleotide repeat containing 6B|TNRC6B|Cbl27|androgen receptor-related apoptosis-associated protein CBL27|2700090M07Rik|A730065C02Rik|AI848765|D230019K20Rik|hm:zeh0114|im:6968518|wu:fa01f05|fa01f05|trinucleotide repeat containing 6B S homeolog|tnrc6b.S|trinucleotide repeat-containing gene 6B protein-like |
Gene, Accession # | Gene ID: 23112, 192178, 213988 |
Catalog # | ABIN633454 |
Price | $1020 |
Order / More Info | TNRC6B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |