Edit |   |
---|---|
Antigenic Specificity | WDR13 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-WDR13 polyclonal antibody, unconjugated |
Immunogen | WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV |
Other Names | MG21|WD repeat-containing protein 13|WD repeat domain 13|WDR13|1700060B08Rik|5730411P10Rik|DXHXS7467e|W51679|mMg21|WD repeat protein 13|memory-related protein|RGD1560982|MGC80988|WD repeat domain 13 L homeolog|wdr13.L|WD family protein WDR13|MGC79608|WD repeat domain 13 protein|DKFZp469E2032 |
Gene, Accession # | Gene ID: 64743, 73447, 317370, 480904 |
Catalog # | ABIN629704 |
Price | $902 |
Order / More Info | WDR13 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |