Edit |   |
---|---|
Antigenic Specificity | KLRAQ1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-KLRAQ1 polyclonal antibody, unconjugated |
Immunogen | CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE |
Other Names | 1110018J12Rik|AI426045|AW550781|Ccdc128|Klraq1|KLRAQ motif containing 1|KLRAQ motif-containing protein 1|coiled-coil domain containing 128|coiled-coil domain-containing protein 128|protein phosphatase 1 regulatory subunit 21|protein phosphatase 1, regulatory subunit 21|Ppp1r21|protein phosphatase 1 regulatory subunit 21 L homeolog|ppp1r21.L|smooth muscle myosin heavy chain 11 isoform SM1-like|KLRAQ motif-containing protein 1-like|zgc:92087|RGD1565310 |
Gene, Accession # | Gene ID: 73825, 129285, 362697 |
Catalog # | ABIN631762 |
Price | $1020 |
Order / More Info | KLRAQ1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |