Edit |   |
---|---|
Antigenic Specificity | ZDHHC13 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ZDHHC13 polyclonal antibody, unconjugated |
Immunogen | ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV |
Other Names | HIP14L|HIP3RP|DHHC-13|HIP14-related protein|huntingtin interacting protein HIP3RP|huntingtin-interacting protein 14-related protein|huntingtin-interacting protein HIP3RP|palmitoyltransferase ZDHHC13|probable palmitoyltransferase ZDHHC13|putative MAPK-activating protein PM03|putative NF-kappa-B-activating protein 209|zinc finger DHHC domain-containing protein 13|zinc finger|DHHC domain containing 13|zinc finger DHHC-type containing 13|ZDHHC13|Zinc Finger, DHHC-Type Containing 13|DHHC-type containing 13|wu:fb06e01|wu:fc39g10|wu:fi22e09|zgc:101690|fi22e09|2410004E01Rik|C530010M18|kojak|skc4|zinc finger, DHHC domain containing 13 |
Gene, Accession # | Gene ID: 54503, 243983, 365252 |
Catalog # | ABIN630234 |
Price | $902 |
Order / More Info | ZDHHC13 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |