Edit |   |
---|---|
Antigenic Specificity | STUB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-STUB1 polyclonal antibody, unconjugated |
Immunogen | STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF |
Other Names | CHIP|HSPABP2|NY-CO-7|SDCCAG7|UBOX1|CLL-associated antigen KW-8|E3 ubiquitin-protein ligase CHIP|STIP1 homology and U box-containing protein 1|antigen NY-CO-7|carboxy terminus of Hsp70-interacting protein|heat shock protein A binding protein 2 (c-terminal)|serologically defined colon cancer antigen 7|STIP1 homology and U-box containing protein 1|STUB1|0610033N24Rik|2210017D18Rik|2310040B03Rik|AW046544|wu:fc22f04|zgc:56076|STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase L homeolog|stub1.L|STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase|LOC100282870 |
Gene, Accession # | Gene ID: 10273, 56424, 287155 |
Catalog # | ABIN631354 |
Price | $1020 |
Order / More Info | STUB1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |