Edit |   |
---|---|
Antigenic Specificity | PRMT1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PRMT1 polyclonal antibody, unconjugated |
Immunogen | PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY |
Other Names | ANM1|HCP1|HRMT1L2|IR1B4|HMT1 (hnRNP methyltransferase|S. cerevisiae)-like 2|heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2|histone-arginine N-methyltransferase PRMT1|interferon receptor 1-bound protein 4|protein arginine N-methyltransferase 1|protein arginine methyltransferase 1|PRMT1|6720434D09Rik|AW214366|Mrmt1|arginine N-methyltransferase 1|heterogeneous nuclear ribonucleoproteins methyltransferase-like 2|3E10|xPRMT1|xPRMT1b|histone-arginine N-methyltransferase PRMT1-A|protein arginine N-methyltransferase 1-A|protein arginine methyltransferase 1 S homeolog|prmt1.S|ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 1A|ATPRMT1A|F6F22.30|F6F22_30|protein arginine methyltransferase 1A|PRMT1A|protein arginine N-methyltransferase-1|prm-1|EDI_007800|Smp_029240.3|protein arginine N-methyltransferase|DDBDRAFT_0183976|DDBDRAFT_0235399|DDB_0183976|DDB_0235399|protein arginine methyltransferase|DKFZp459J1326|fb39h07|wu:fb39h07|zf1|zgc:66201|HMT1 hnRNP methyltransferase-like 2 |
Gene, Accession # | Gene ID: 3276, 15469, 60421, 321974, 476411 |
Catalog # | ABIN629816 |
Price | $902 |
Order / More Info | PRMT1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |