Edit |   |
---|---|
Antigenic Specificity | CACNA1I |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CACNA1I polyclonal antibody, unconjugated |
Immunogen | CACNA1 I antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS |
Other Names | Cav3.3|ca(v)3.3|calcium channel|voltage-dependent|alpha 1I subunit|voltage-dependent T-type calcium channel subunit alpha-1I|voltage-gated calcium channel subunit alpha Cav3.3|calcium voltage-gated channel subunit alpha1 I|CACNA1I|Calcium Channel, Voltage Dependent, T Type, alpha 1I Subunit|caVT.3|hypothetical gene supported by NM_020084|low voltage-activated T-type calcium channel alpha-1 subunit (CACNA1I)|voltage-dependent calcium channel|low-voltage-activated calcium channel alpha13.3|calcium channel, voltage-dependent, alpha 1I subunit|CACNA1L|alpha1I T-type calcium channel subunit|T type|voltage-dependent T-type calcium channel alpha-1I subunit|si:ch211-51h13.1|calcium channel, voltage-dependent, T type, alpha 1I subunit|voltage-dependent T-type calcium channel subunit alpha-1I-like|LOC100555412|LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I |
Gene, Accession # | Gene ID: 8911, 56827, 239556 |
Catalog # | ABIN633706 |
Price | $1020 |
Order / More Info | CACNA1I Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |