Edit |   |
---|---|
Antigenic Specificity | JARID2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-JARID2 polyclonal antibody, unconjugated |
Immunogen | JARID2 antibody was raised using the N terminal of JARID2 corresponding to a region with amino acids THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ |
Other Names | JMJ|jumonji homolog|jumonji-like protein|jumonjiARID domain-containing protein 2|protein Jumonji|jumonji and AT-rich interaction domain containing 2|JARID2|Jumonji, AT Rich Interactive Domain 2|jumonji|AT rich interactive domain 2 protein|AT rich interactive domain 2|jumonji, AT rich interactive domain 2a|jarid2a|protein Jumonji-like|si:dkey-211c3.1|jumonji, AT rich interactive domain 2b|jarid2b|jarid2-a|jarid2-b|jarid2.S|jumonji and AT-rich interaction domain containing 2 L homeolog|jumonji and AT-rich interaction domain containing 2 S homeolog|AT rich interactive domain 2 b|jarid2.L |
Gene, Accession # | Gene ID: 3720 |
Catalog # | ABIN633819 |
Price | $1020 |
Order / More Info | JARID2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |