Edit |   |
---|---|
Antigenic Specificity | INTS6 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-INTS6 polyclonal antibody, unconjugated |
Immunogen | INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK |
Other Names | DBI-1|DDX26|DDX26A|DICE1|HDB|INT6|Notchl2|DEAD box protein|DEADH (Asp-Glu-Ala-AspHis) box polypeptide 26|RNA helicase HDB|protein deleted in cancer 1|integrator complex subunit 6|INTS6|EIF3-P48|EIF3S6|eIF3-p46|eIF-3 p48|eukaryotic translation initiation factor 3 subunit 6|eukaryotic translation initiation factor 3 subunit E|eukaryotic translation initiation factor 3|subunit 6 (48kD)|subunit 6 48kDa|mammary tumor-associated protein INT6|murine mammary tumor integration site 6 (oncogene homolog)|viral integration site protein INT-6 homolog|EIF3E|2900075H24Rik|AI480962|Notch2l|LRRGT00024|integrator complex subunit 6-like|ints6-b|int6-B|integrator complex subunit 6-B|integrator complex subunit 6 S homeolog|ints6.S|Tsp_09465|LOC100164318|Int6-A|ints6-a|integrator complex subunit 6-A|integrator complex subunit 6 L homeolog|ints6.L |
Gene, Accession # | Gene ID: 26512 |
Catalog # | ABIN633264 |
Price | $1020 |
Order / More Info | INTS6 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |