Edit |   |
---|---|
Antigenic Specificity | VDAC3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-VDAC3 polyclonal antibody, unconjugated |
Immunogen | VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
Other Names | HD-VDAC3|VDAC-3|outer mitochondrial membrane protein porin 3|voltage-dependent anion-selective channel protein 3|voltage dependent anion channel 3|VDAC3|Voltage-Dependent Anion Channel 3|channel protein VDAC3|mVDAC3|mitochondrial outer membrane protein|mitochondrial voltage dependent anion channel 3|rVDAC3|VDAC1P5|VDAC5P|voltage-dependent anion channel 1 pseudogene 5|voltage-dependent anion channel 5|pseudogene|wu:fb01e12|zgc:77898|voltage-dependent anion channel 3 L homeolog|vdac3.L|ARABIDOPSIS THALIANA VOLTAGE DEPENDENT ANION CHANNEL 3|ATVDAC3|Athsr2|F2G14.210|F2G14_210|Protein HYPERSENSITIVE RESPONSE 2 |
Gene, Accession # | Gene ID: 7419, 22335, 83532 |
Catalog # | ABIN633623 |
Price | $1020 |
Order / More Info | VDAC3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |