Edit |   |
---|---|
Antigenic Specificity | MUC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MUC1 polyclonal antibody, unconjugated |
Immunogen | MUC1 antibody was raised using the C terminal of MUC1 corresponding to a region with amino acids GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL |
Other Names | CA 15-3|CD227|EMA|H23AG|KL-6|MAM6|MCKD1|MUC-1|MUC-1SEC|MUC-1X|MUC1D|PEM|PEMT|PUM|DF3 antigen|H23 antigen|breast carcinoma-associated antigen DF3|cancer antigen 15-3|carcinoma-associated mucin|episialin|krebs von den Lungen-6|mucin 1|transmembrane|mucin-1|peanut-reactive urinary mucin|polymorphic epithelial mucin|tumor associated epithelial mucin|tumor-associated epithelial membrane antigen|tumor-associated mucin|mucin 1, cell surface associated|MUC1|mucin 1, transmembrane|endometrial mucin-1|Mucin1|epithelial mucin |
Gene, Accession # | Gene ID: 4582, 17829, 448784 |
Catalog # | ABIN635541 |
Price | $1020 |
Order / More Info | MUC1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |