Edit |   |
---|---|
Antigenic Specificity | LCK |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-LCK polyclonal antibody, unconjugated |
Immunogen | LCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE |
Other Names | LSK|YT16|p56lck|pp58lck|T-lymphocyte specific protein tyrosine kinase p56lck|leukocyte C-terminal Src kinase|lymphocyte cell-specific protein-tyrosine kinase|p56(LSTRA) protein-tyrosine kinase|proto-oncogene tyrosine-protein kinase LCK|t cell-specific protein-tyrosine kinase|tyrosine-protein kinase Lck|LCK proto-oncogene, Src family tyrosine kinase|LCK|Lymphocyte-Specific Protein tyrosine Kinase|Lck1|Lcktkr|lymphocyte protein tyrosine kinase|p56-LCK|zgc:136695|tyrosine-protein kinase Lck-like|Hck-3|Lskt|p56 |
Gene, Accession # | Gene ID: 16818, 313050 |
Catalog # | ABIN631231 |
Price | $1020 |
Order / More Info | LCK Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |