Edit |   |
---|---|
Antigenic Specificity | CELF1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CELF1 polyclonal antibody, unconjugated |
Immunogen | CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT |
Other Names | BRUNOL2|CUG-BP|CUGBP|CUGBP1|EDEN-BP|NAB50|NAPOR|hNab50|50 kDa nuclear polyadenylated RNA-binding protein|CELF-1|CUG RNA-binding protein|CUG triplet repeat RNA-binding protein 1|CUG triplet repeat|RNA binding protein 1|RNA-binding protein 1|CUG-BP- and ETR-3-like factor 1|CUG-BP1|CUGBP Elav-like family member 1|EDEN-BP homolog|RNA-binding protein BRUNOL-2|bruno-like 2|bruno-like protein 2|deadenylation factor CUG-BP|embryo deadenylation element binding protein|embryo deadenylation element-binding protein homolog|nuclear polyadenylated RNA-binding protein|50-kD|CELF1|CUGBP, Elav-Like Family Member 1|cugbp1-a|edenbp|CELF-1A|CUG triplet repeat RNA-binding protein 1-A|CUG-BP- and ETR-3-like factor 1-A|CUG-BP1-A|CUGBP Elav-like family member 1-A|EDEN-BP-A|RNA-binding protein BRUNOL-2-A|bruno-like protein 2-A|embryo deadenylation element-binding protein A|p53p55|CUGBP Elav-like family member 1 L homeolog|celf1.L|Bruno-like|brul|cb920|EDEN-BPBruno-like protein|1600010O03Rik|AA407467|D2Wsu101e|brain protein F41|deadenylation factor EDEN-BP|cugbp1-b|CELF-1B|CUG triplet repeat RNA-binding protein 1-B|CUG-BP- and ETR-3-like factor 1-B|CUG-BP1-B|CUGBP Elav-like family member 1-B|EDEN-BP-B|RNA-binding protein BRUNOL-2-B|bruno-like protein 2-B|embryo deadenylation element-binding protein B|CUGBP Elav-like family member 1 S homeolog|celf1.S |
Gene, Accession # | Gene ID: 10658, 13046, 362160 |
Catalog # | ABIN633435 |
Price | $1020 |
Order / More Info | CELF1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |