Edit |   |
---|---|
Antigenic Specificity | Angiotensin II Type-1 Receptor |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Angiotensin II Type-1 Receptor polyclonal antibody, unconjugated |
Immunogen | AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Other Names | AG2S|AGTR1A|AGTR1B|AT1|AT1AR|AT1B|AT1BR|AT1R|AT2R1|AT2R1A|AT2R1B|HAT1R|type-1 angiotensin II receptor|type-1B angiotensin II receptor|angiotensin II receptor type 1|AGTR1|Angiotensin II Receptor, Type 1|Angiotensin II Type-1 Receptor|1810074K20Rik|AI551199|AT1a|Agtr-1a|Angtr-1a|angiotensin II type-1A receptor|angiotensin receptor 1|angiotensin receptor 1a|type-1A angiotensin II receptor|angiotensin II receptor, type 1a|angiotensin II receptor 1|XAT-1|agtr1-A|agtr1.2|AT1-2|angiotensin 2 receptor|type 1|gene 2|type 1-B|angiotensin II receptor|angiotensin II type-1 receptor 2|angiotensin type 1 receptor|type-1 angiotensin II receptor B|type-1-like angiotensin II receptor 2|angiotensin II receptor type 1 S homeolog|agtr1.S|AT1-R|angiotensin II type 1 receptor|AT1 ANG II receptor|AT1 angiotensin II receptor|angiotensin receptor|uncharacterized AGTR1|Agtr-1b|Angtr-1b|AT3|angiotensin II type-1B receptor|angiotensin II receptor, type 1b|agtr1-b|xAT|AT1-1|type 1-A|Type-1-like angiotensin II receptor 1|type 1 L homeolog|angiotensin II type-1 receptor 1|angiotensin type 1|type-1 angiotensin II receptor A|angiotensin II receptor type 1 L homeolog|agtr1.L |
Gene, Accession # | Gene ID: 185, 11607, 81638 |
Catalog # | ABIN634511 |
Price | $1020 |
Order / More Info | Angiotensin II Type-1 Receptor Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |