Edit |   |
---|---|
Antigenic Specificity | RPS14 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, Drosophila melanogaster, human, mouse, rat, zebrafish |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RPS14 polyclonal antibody, unconjugated |
Immunogen | RPS14 antibody was raised using the middle region of RPS14 corresponding to a region with amino acids GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL |
Other Names | EMTB|S14|40S ribosomal protein S14|emetine resistance|ribosomal protein S14|RPS14|2600014J02Rik|AL023078|rps-14|fa92e08|wu:fa92e08|zgc:73215|ribosomal protein S14 L homeolog|rps14.L|30S ribosomal protein S14|LOC100286294|CG1527|DmelCG1527|RPS14B|S14b|anon-EST:Posey115|anon-EST:Posey131|anon-EST:Posey154|anon-EST:Posey77|CG1527-PA|RpS14b-PA|ribosomal protein S14b|28S ribosomal protein S14|mitochondrial|mitochondrial ribosomal protein S14|MRPS14 |
Gene, Accession # | Gene ID: 6208, 20044, 29284, 47219, 336687, 403690 |
Catalog # | ABIN629964 |
Price | $902 |
Order / More Info | RPS14 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |