Edit |   |
---|---|
Antigenic Specificity | IFRD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-IFRD1 polyclonal antibody, unconjugated |
Immunogen | IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL |
Other Names | PC4|TIS7|12-O-tetradecanoylphorbol-13-acetate-induced sequence 7|TPA induced sequence 7|nerve growth factor-inducible protein PC4|pheochromocytoma cell-4|interferon related developmental regulator 1|IFRD1|Ifnl|TPA-induced sequence 7|interferon-related developmental regulator 1|IRPR|im:7067566|si:dkey-192l17.2|wu:fi35f04|wu:fj67a06|zgc:154080|interferon related developmental regulator 1 L homeolog|ifrd1.L|IFR1 |
Gene, Accession # | Gene ID: 3475, 15982, 29596 |
Catalog # | ABIN630559 |
Price | $1020 |
Order / More Info | IFRD1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |