Edit |   |
---|---|
Antigenic Specificity | PDE1C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PDE1C polyclonal antibody, unconjugated |
Immunogen | PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST |
Other Names | Hcam3|Human 3'|5' cyclic nucleotide phosphodiesterase (HSPDE1C1A)|calciumcalmodulin-dependent 3'|5'-cyclic nucleotide phosphodiesterase 1C|cam-PDE 1C|hCam-3|phosphodiesterase 1C|PDE1C|phosphodiesterase 1C, Calmodulin-Dependent 70kDa|CG14940|CG14942|CG14943|CG14944|CG31757|CG31758|CG42325|CG44007|DmelCG44007|Dmel_CG14940|Dmel_CG14943|Dmel_CG14944|Dmel_CG31757|Dmel_CG31758|Dmel_CG42325|CG44007-PB|CG44007-PC|CG44007-PD|CG44007-PE|CG44007-PG|CG44007-PH|CG44007-PJ|CG44007-PK|Pde1c-PB|Pde1c-PC|Pde1c-PD|Pde1c-PE|Pde1c-PG|Pde1c-PH|Pde1c-PJ|Pde1c-PK|cyclic nucleotide phosphodiesterase 1 C|phosphodiesterase 1C calmodulin-dependent (70kD)|calmodulin-dependent 70kDa|GB13690|calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A|LOC724389|calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C|LOC100019026|5'-cyclic nucleotide phosphodiesterase 1C-like|phosphodiesterase 1C, calmodulin-dependent b|pde1cb |
Gene, Accession # | Gene ID: 18575, 81742 |
Catalog # | ABIN630963 |
Price | $1020 |
Order / More Info | PDE1C Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |