Edit |   |
---|---|
Antigenic Specificity | ST3GAL2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ST3GAL2 polyclonal antibody, unconjugated |
Immunogen | ST3 GAL2 antibody was raised using the C terminal of ST3 AL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN |
Other Names | Gal-NAc6S|SIAT4B|ST3GALII|ST3GalA.2|CMP-N-acetylneuraminate-beta-galactosamide-alpha-2|3-sialyltransferase 2|Gal-beta-1|3-GalNAc-alpha-2|3-sialyltransferase|SIAT4-B|ST3Gal II|alpha 2|3-ST 2|beta-galactoside alpha-2|3-sialytransferase|sialyltransferase 4B (beta-galactosidase alpha-2|3-sialytransferase)|ST3 beta-galactoside alpha-2,3-sialyltransferase 2|ST3GAL2|AI429591|AW822065|Siat5|sialyltransferase 4B|sialyltransferase 5|sialyltransferase 4B (beta-galactoside alpha-2|3-sialyltransferase)|si:ch211-223o1.7|3-sialyltransferase ST3Gal II|alpha-2|st3Gal II.2|st3gal2-r1|ST3GAL-II|alpha2|sialyltransferase ST3Gal-II |
Gene, Accession # | Gene ID: 6483, 20444, 64442 |
Catalog # | ABIN635969 |
Price | $1020 |
Order / More Info | ST3GAL2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |