Edit |   |
---|---|
Antigenic Specificity | ATP7A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ATP7A polyclonal antibody, unconjugated |
Immunogen | ATP7 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ |
Other Names | DSMAX|MK|MNK|SMAX3|Cu++-transporting P-type ATPase|Menkes disease-associated protein|copper pump 1|copper-transporting ATPase 1|ATPase copper transporting alpha|ATP7A|ATPase, Cu++ Transporting, alpha Polypeptide|ATPase|Cu++ transporting|alpha polypeptide|Blo|DXHXS1608e|I14|Mo|blotchy|br|brindled|mottled|Menkes protein|menkes disease-associated protein homolog|alpha polypeptide (Menkes syndrome)|copper transporting ATPase|cal|wu:fc43e01|zgc:153422|zgc:158633|Menkes disease ATPase|calamity|copper-transporting P-type ATPase|DDBDRAFT_0218568|DDBDRAFT_0235190|DDB_0218568|DDB_0235190|copper-transporting ATPase|P-type ATPase|ATPase protein|ATP synthase subunit a|LOC100049514|kal|kaleidoscope|copper-transporting ATPase 1-like|LOC412379|LOW QUALITY PROTEIN: copper-transporting ATPase 1|copper-binding ATPase |
Gene, Accession # | Gene ID: 538, 406185 |
Catalog # | ABIN629724 |
Price | $902 |
Order / More Info | ATP7A Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |