Edit |   |
---|---|
Antigenic Specificity | Claudin 18 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-Claudin 18 polyclonal antibody, unconjugated |
Immunogen | Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
Other Names | SFTA5|SFTPJ|claudin-18|surfactant associated 5|surfactant associated protein J|surfactant|pulmonary associated protein J|claudin 18|CLDN18|claudin 18-like|claudin 18 L homeolog|cldn18.L |
Gene, Accession # | Gene ID: 51208 |
Catalog # | ABIN635505 |
Price | $1020 |
Order / More Info | Claudin 18 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |