Edit |   |
---|---|
Antigenic Specificity | CENPA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CENPA polyclonal antibody, unconjugated |
Immunogen | CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG |
Other Names | CENP-A|CenH3|centromere autoantigen A|centromere protein A|17kDa|centromere-specific histone|histone H3-like centromeric protein A|CENPA|centrosomin A|centromere protein-A|cenpx|centromere protein|Xenopus|centromeric histone-3 like protein|sim2|centromere-specific histone H3 CENP-A|cnp1|HAN_3g422|ggCENP-A|RGD1563607|centromere protein A L homeolog|cenpa.L|CMU_016480 |
Gene, Accession # | Gene ID: 1058, 298850 |
Catalog # | ABIN630727 |
Price | $1020 |
Order / More Info | CENPA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |