Edit |   |
---|---|
Antigenic Specificity | PTPRA |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PTPRA polyclonal antibody, unconjugated |
Immunogen | PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG |
Other Names | HEPTP|HLPR|HPTPA|HPTPalpha|LRP|PTPA|PTPRL2|R-PTP-alpha|RPTPA|Leukocyte common antigen-related peptide (protein tyrosine phosphate)|PTPLCA-related phosphatase|PTPase-alpha|protein tyrosine phosphatase|receptor type|alpha polypeptide|protein-tyrosine phosphatase alpha|receptor-type tyrosine-protein phosphatase alpha|tyrosine phosphatase alpha|protein tyrosine phosphatase, receptor type A|PTPRA|Protein tyrosine Phosphatase, Receptor Type, A|zf-RPTPa|A|receptor-type tyrosine-protein phosphatase alpha-like|protein tyrosine phosphatase alpha|ptpa-a|protein tyrosine phosphatase, receptor type A S homeolog|ptpra.S|Ptpalpha|Rptpalpha|Rptra|Rptralpha|LCA-related phosphatase|PTPTY-28|protein tyrosine phosphatase receptor type alpha|protein-tyrosine-phosphatase alpha |
Gene, Accession # | Gene ID: 5786, 19262, 25167 |
Catalog # | ABIN635883 |
Price | $1020 |
Order / More Info | PTPRA Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |