Edit |   |
---|---|
Antigenic Specificity | PLP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-PLP2 polyclonal antibody, unconjugated |
Immunogen | PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV |
Other Names | A4|A4LSB|A4 differentiation-dependent protein|differentiation-dependent protein A4|intestinal membrane A4 protein|proteolipid protein 2|PLP2|mIMA4|A4-LSB|Proteolipid protein 2 (intestinal membrane A4 protein)|proteolipid protein 2 (colonic epithelium-enriched) S homeolog|proteolipid protein 2 S homeolog|plp2.S |
Gene, Accession # | Gene ID: 5355, 480914 |
Catalog # | ABIN630464 |
Price | $902 |
Order / More Info | PLP2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |