Edit |   |
---|---|
Antigenic Specificity | CEND1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-CEND1 polyclonal antibody, unconjugated |
Immunogen | CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ |
Other Names | BM88|BM88 antigen|cell cycle exit and neuronal differentiation protein 1|cell cycle exit and neuronal differentiation 1|CEND1|1500001H12Rik|AI415214|C38|RGD1309401 |
Gene, Accession # | Gene ID: 51280, 57754, 361675 |
Catalog # | ABIN635055 |
Price | $1020 |
Order / More Info | CEND1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |