Edit |   |
---|---|
Antigenic Specificity | RSU1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-RSU1 polyclonal antibody, unconjugated |
Immunogen | RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK |
Other Names | RSP-1|ras suppressor protein 1|ras suppressor protein 1 variant 1|ras suppressor protein 1 variant 2|ras suppressor protein 1 variant 3|rsu-1|RSU1|RsuI|etID12695|si:dz63m2.1|cubilin|Ras suppressor protein 1 S homeolog|rsu1.S |
Gene, Accession # | Gene ID: 6251, 20163, 680419 |
Catalog # | ABIN629715 |
Price | $902 |
Order / More Info | RSU1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |