Edit |   |
---|---|
Antigenic Specificity | HNRNPA1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HNRNPA1 polyclonal antibody, unconjugated |
Immunogen | HNRPA1 antibody was raised using the C terminal of HNRPA1 corresponding to a region with amino acids NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSG |
Other Names | HNRPA1|HNRPA1L3|hnRNP A1|hnRNP-A1|Putative heterogeneous nuclear ribonucleoprotein A1-like 3|helix-destabilizing protein|heterogeneous nuclear ribonucleoprotein A1B protein|heterogeneous nuclear ribonucleoprotein B2 protein|heterogeneous nuclear ribonucleoprotein core protein A1|hnRNP A1-like 3|hnRNP core protein A1|hnRNP core protein A1-like 3|nuclear ribonucleoprotein particle A1 protein|single-strand DNA-binding protein UP1|single-strand RNA-binding protein|heterogeneous nuclear ribonucleoprotein A1|HNRNPA1|heterogeneous nuclear ribonucleoprotein A1b|hnrnpa1b|hnRNP A1-gamma isoform|single-strand-binding protein|TPT1P|hormonally upregulated Neu-associated kinase|LOC100101226|roa1|D15Ertd119e|Hdp|HDP-1|helix destabilizing protein|topoisomerase-inhibitor suppressed|heterogeneous ribonuclear particle protein|heterogeneous nuclear ribonucleoprotein A1 S homeolog|hnrnpa1.S|heterogeneous nuclear ribonucleoproteins A1 homolog|ribonucleoprotein A1a|UP1|unwinding protein 1|heterogeneous nuclear ribonucleoprotein A1-like|LOC100359118|zgc:66127|heterogeneous nuclear ribonucleoprotein A1a|hnrnpa1a |
Gene, Accession # | Gene ID: 3178, 15382, 29578 |
Catalog # | ABIN629886 |
Price | $902 |
Order / More Info | HNRNPA1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |