Edit |   |
---|---|
Antigenic Specificity | ERLIN1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ERLIN1 polyclonal antibody, unconjugated |
Immunogen | ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH |
Other Names | C10orf69|Erlin-1|KE04|KEO4|SPFH1|Band_7 23-211 Keo4 (Interim) similar to C.elegans protein C42C1.9|SPFH domain family|member 1|SPFH domain-containing protein 1|endoplasmic reticulum lipid raft-associated protein 1|stomatin-prohibitin-flotillin-HflCK domain-containing protein 1|ER lipid raft associated 1|ERLIN1|wu:fa10h05|wu:fb19h05|zgc:110547|fa10h05|fb19h05|erlin-1-like|ER lipid raft-associated 1|2810439N09Rik|C80197|protein KE04 homolog|RGD1307058 |
Gene, Accession # | Gene ID: 10613, 226144, 293939 |
Catalog # | ABIN635966 |
Price | $1020 |
Order / More Info | ERLIN1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |