Edit |   |
---|---|
Antigenic Specificity | HNRNPA3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µg |
Concentration | lot specific |
Applications | Immunohistochemistry, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-HNRNPA3 polyclonal antibody, unconjugated |
Immunogen | HNRPA3 antibody was raised using the N terminal of HNRPA3 corresponding to a region with amino acids MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS |
Other Names | 2610510D13Rik|D10S102|FBRNP|HNRPA3|hnRNP A3|heterogeneous nuclear ribonucleoprotein A3|HNRNPA3|2410013L13Rik|2610209F03Rik|heterogeneous nuclear ribonucleoprotein A3 homolog 2|hnRNP A3(B)|heterogeneous nuclear ribonucleoprotein A3 S homeolog|hnrnpa3.S|heterogeneous nuclear ribonucleoprotein A1|HNRNPA1|zgc:153703|hypothetical protein|ARCVE_RS10260|DKFZp469I0118 |
Gene, Accession # | Gene ID: 220988, 229279, 362152, 608074 |
Catalog # | ABIN630036 |
Price | $902 |
Order / More Info | HNRNPA3 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |