Edit |   |
---|---|
Antigenic Specificity | ADAR |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-ADAR polyclonal antibody, unconjugated |
Immunogen | ADAR antibody was raised using the N terminal of ADAR corresponding to a region with amino acids GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS |
Other Names | ADAR1|AGS6|DRADA|DSH|DSRAD|G1P1|IFI-4|IFI4|K88DSRBP|P136|136 kDa double-stranded RNA-binding protein|adenosine deaminase acting on RNA 1-A|double-stranded RNA-specific adenosine deaminase|dsRNA adenosine deaminase|interferon-induced protein 4|interferon-inducible protein 4|adenosine deaminase, RNA specific|ADAR|Adenosine Deaminase, RNA-Specific|red1|wu:fc22a02|dsRAD-1|adenosine deaminase, RNA-specific S homeolog|adar.S|adenosine deaminase|RNA-specific|RNA-specific adenosine deaminase|CG12598|DmelCG12598|EG:BACN35H14.1|adr|dADAR|hypnos-2|Adar-PA|Adar-PB|Adar-PC|Adar-PD|Adar-PE|Adar-PF|Adar-PH|Adar-PI|Adar-PJ|Adar-PK|Adar-PL|Adar-PM|CG12598-PA|CG12598-PB|CG12598-PC|CG12598-PD|CG12598-PE|CG12598-PF|CG12598-PH|CG12598-PI|CG12598-PJ|CG12598-PK|CG12598-PL|CG12598-PM|adenosine deaminase acting on RNA|adenosine deaminases acting on RNA|hypoxia|anoxia|sensitive 2|CpipJ_CPIJ011849|NV18763|double-stranded RNA-specific editase 1|LOC100114127|AV242451|mZaADAR|RNA adenosine deaminase 1|RNA-specific adenosine deaminase p110 form|RNA-specific adenosine deaminase p150 form|LOW QUALITY PROTEIN: double-stranded RNA-specific adenosine deaminase |
Gene, Accession # | Gene ID: 103 |
Catalog # | ABIN634454 |
Price | $1020 |
Order / More Info | ADAR Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |