Edit |   |
---|---|
Antigenic Specificity | MAP3K1 |
Clone | 2F6 |
Host Species | Mouse |
Reactive Species | human |
Isotype | IgG2a kappa |
Format | unconjugated |
Size | 100 µg |
Concentration | 200 µg/mL |
Applications | Immunohistochemistry, Staining Methods, Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Mouse anti-MAP3K1 monoclonal antibody, unconjugated |
Immunogen | Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK) |
Other Names | MAPKKK1|MEKK|MEKK 1|MEKK1|SRXY6|MAPERK kinase kinase 1|MAPKERK kinase kinase 1|MEK kinase 1|mitogen-activated protein kinase kinase kinase 1|MAP3K1|mitogen activated protein kinase kinase kinase 1|mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase|ARAKIN|ATMEKK1|MAPKKK8|T15F16.5|T15F16_5|MAPK/ERK kinase kinase 1|LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 1|si:rp71-80a19.2 |
Gene, Accession # | Gene ID: 4214 |
Catalog # | ABIN6940032 |
Price | $575 |
Order / More Info | MAP3K1 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |