Edit |   |
---|---|
Antigenic Specificity | TMEM132B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-TMEM132B polyclonal antibody, unconjugated |
Immunogen | TMEM132 B antibody was raised using the middle region of TMEM132 corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK |
Other Names | transmembrane protein 132B|TMEM132B|AK220418|mKIAA1786|RGD1566191|LOC100556911|LOC100606383 |
Gene, Accession # | Gene ID: 114795 |
Catalog # | ABIN635495 |
Price | $1020 |
Order / More Info | TMEM132B Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |