Edit |   |
---|---|
Antigenic Specificity | MVP |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-MVP polyclonal antibody, unconjugated |
Immunogen | MVP antibody was raised using the N terminal of MVP corresponding to a region with amino acids MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRM |
Other Names | LRP|VAULT1|lung resistance-related protein|major vault protein|MVP|2310009M24Rik|cb771|wu:fb52b05|wu:fc02g01|major vault protein L homeolog|mvp.L|MGC145641|Tc00.1047053510353.10|Tb05.45E22.810|Tb927.5.4460|Tb10.70.0520|Tb10.70.5840|putative major vault protein|LMJF_05_0060|lung resistance-associated protein |
Gene, Accession # | Gene ID: 9961, 64681, 78388 |
Catalog # | ABIN630625 |
Price | $1020 |
Order / More Info | MVP Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |