Edit |   |
---|---|
Antigenic Specificity | SLC20A2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | dog, human, mouse, rat |
Isotype | n/a |
Format | unconjugated |
Size | 100 µL |
Concentration | lot specific |
Applications | Western Blotting |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-SLC20A2 polyclonal antibody, unconjugated |
Immunogen | SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF |
Other Names | GLVR-2|GLVR2|IBGC3|MLVAR|PIT-2|PIT2|RAM1|gibbon ape leukemia virus receptor 2|murine leukemia virus|amphotropic|receptor for|sodium-dependent phosphate transporter 2|solute carrier family 20 member 2|SLC20A2|Solute Carrier Family 20 (Phosphate Transporter), Member 2|solute carrier family 20 (phosphate transporter)|member 2|sodium-dependent phosphate transporter 2-like|solute carrier family 20 (phosphate transporter), member 2 L homeolog|slc20a2.L|Ab1-188|RAM-1|phosphate transporter 2|receptor for amphitropic viruses 1|receptor for amphotropic viruses 1|solute carrier family 20|MolPit2|type III sodium-dependent phosphate transporter|solute carrier family 20, member 2|wu:fi23g11|zgc:152990|fi23g11|fePit2|receptor Pit2|ChoPit2|HaPit2|Amphotropic murine leukemia virus receptor|Amphotropic murine retrovirus receptor |
Gene, Accession # | Gene ID: 6575, 20516, 29502, 482838 |
Catalog # | ABIN636107 |
Price | $1020 |
Order / More Info | SLC20A2 Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |